PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_52315.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YA
Protein Properties Length: 142aa    MW: 15463.3 Da    PI: 7.1581
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_52315.7genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA51.43.6e-16106140136
     CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrk 36 
                   +ep+YVNaKQy++Il+RRq+Rak+e+e+kl +k+rk
  MLOC_52315.7 106 EEPVYVNAKQYNAILRRRQSRAKAESERKL-IKGRK 140
                   69****************************.99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005210.0034104142IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115220.188105142IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.3E-11107140IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860110130IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MTSVADAVSG DHRADEQQQK QAAHGNQEEA PATSIGNQAM AATPSTDYVT PYGHQEACHA  60
MGQIAYPTID PYYGSLYAAY GGQPMMHPPM VGMHAAAIPL PTDAIEEPVY VNAKQYNAIL  120
RRRQSRAKAE SERKLIKGRK YS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3639340.0AK363934.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2020D05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237027.11e-75PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_010237028.11e-75PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_010237029.18e-76PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X2
RefseqXP_014758866.11e-75PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLM0WKA51e-101M0WKA5_HORVD; Uncharacterized protein
STRINGMLOC_52315.11e-97(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.38e-25nuclear factor Y, subunit A1